Lineage for d12asa_ (12as A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82887Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 82888Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 82889Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 82890Protein Asparagine synthetase [55705] (1 species)
  7. 82891Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. 82892Domain d12asa_: 12as A: [40783]

Details for d12asa_

PDB Entry: 12as (more details), 2.2 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp

SCOP Domain Sequences for d12asa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d12asa_ d.104.1.1 (A:) Asparagine synthetase {Escherichia coli}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOP Domain Coordinates for d12asa_:

Click to download the PDB-style file with coordinates for d12asa_.
(The format of our PDB-style files is described here.)

Timeline for d12asa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d12asb_