Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species) |
Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries) |
Domain d1efwb3: 1efw B:105-294,B:415-580 [40774] Other proteins in same PDB: d1efwa1, d1efwa2, d1efwb1, d1efwb2 protein/RNA complex |
PDB Entry: 1efw (more details), 3 Å
SCOPe Domain Sequences for d1efwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efwb3 d.104.1.1 (B:105-294,B:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp
Timeline for d1efwb3: