SCOP 1.55: Domain d1efwb3: 1efw B:105-294,B:415-580

Lineage for d1efwb3 (1efw B:105-294,B:415-580)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)

7. Species Thermus thermophilus [TaxId:274] [55700] (2 PDB entries)

8. Domain d1efwb3: 1efw B:105-294,B:415-580 [40774]
   Other proteins in same PDB: d1efwa1, d1efwa2, d1efwb1, d1efwb2

Details for d1efwb3

PDB Entry: 1efw, 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli

SCOP Domain Sequences for d1efwb3:

Sequence; same for both SEQRES and ATOM records:

>d1efwb3 d.104.1.1 (B:105-294,B:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus}
tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv
qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd
edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame
rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv
ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg
giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp

Timeline for d1efwb3:

• d1efwb3 appears in SCOP 1.57
  
• d1efwb3 appears in the current release, SCOPe 2.08