Lineage for d1efwa2 (1efw A:295-414)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209032Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1209254Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 1209255Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 1209263Protein Prokaryotic AspRS, insert domain [55263] (2 species)
  7. 1209271Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries)
  8. 1209276Domain d1efwa2: 1efw A:295-414 [39737]
    Other proteins in same PDB: d1efwa1, d1efwa3, d1efwb1, d1efwb3
    protein/RNA complex

Details for d1efwa2

PDB Entry: 1efw (more details), 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1efwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efwa2 d.74.4.1 (A:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]}
fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv
eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk

SCOPe Domain Coordinates for d1efwa2:

Click to download the PDB-style file with coordinates for d1efwa2.
(The format of our PDB-style files is described here.)

Timeline for d1efwa2: