Lineage for d1b76a2 (1b76 A:1-394)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 34979Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. 34980Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. 34983Domain d1b76a2: 1b76 A:1-394 [40747]
    Other proteins in same PDB: d1b76a1, d1b76b1

Details for d1b76a2

PDB Entry: 1b76 (more details), 3.4 Å

PDB Description: glycyl-trna synthetase from thermus thermophilus complexed with atp

SCOP Domain Sequences for d1b76a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
vdrgvlallaeaftreelpngeerivlklkp

SCOP Domain Coordinates for d1b76a2:

Click to download the PDB-style file with coordinates for d1b76a2.
(The format of our PDB-style files is described here.)

Timeline for d1b76a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b76a1