Lineage for d1qe0b2 (1qe0 B:1-325)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332805Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 332806Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 332807Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 332853Protein Histidyl-tRNA synthetase (HisRS) [55688] (3 species)
  7. 332867Species Staphylococcus aureus [TaxId:1280] [55690] (1 PDB entry)
  8. 332869Domain d1qe0b2: 1qe0 B:1-325 [40736]
    Other proteins in same PDB: d1qe0a1, d1qe0b1

Details for d1qe0b2

PDB Entry: 1qe0 (more details), 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase

SCOP Domain Sequences for d1qe0b2:

Sequence, based on SEQRES records: (download)

>d1qe0b2 d.104.1.1 (B:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus}
mikiprgtqdilpedskkwryienqldelmtfynykeirtpifestdlfargvgdstdvv
qkemytfkdkgdrsitlrpegtaavvrsyiehkmqgnpnqpiklyyngpmfryerkqkgr
yrqfnqfgveaigaenpsvdaevlamvmhiyqsfglkhlklvinsvgdmasrkeynealv
khfepvihefcsdcqsrlhtdpmrildckvdrdkeaiktapritdflneeskayyeqvka
ylddlgipytedpnlvrgldyythtafelmmdnpnydgaittlcgggryngllelldgps
etgigfalsierlllaleeegield

Sequence, based on observed residues (ATOM records): (download)

>d1qe0b2 d.104.1.1 (B:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus}
mikiprgtqdilpedskkwryienqldelmtfynykeirtpifestdlfaremytfkdkg
drsitlrpegtaavvrsyiehkmqgnpnqpiklyyngpmfryyrqfnqfgveaigaenps
vdaevlamvmhiyqsfglkhlklvinsvgdmasskayyeqvkaylddlgipytedpnlvr
gldyythtafelmmdnpnydgaittlcgggryngllelldgpsetgigfalsierlllal
eeegield

SCOP Domain Coordinates for d1qe0b2:

Click to download the PDB-style file with coordinates for d1qe0b2.
(The format of our PDB-style files is described here.)

Timeline for d1qe0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qe0b1