Lineage for d1qe0a1 (1qe0 A:326-420)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316208Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 316209Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 316210Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 316219Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 316233Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry)
  8. 316234Domain d1qe0a1: 1qe0 A:326-420 [33186]
    Other proteins in same PDB: d1qe0a2, d1qe0b2

Details for d1qe0a1

PDB Entry: 1qe0 (more details), 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase

SCOP Domain Sequences for d1qe0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfkk

SCOP Domain Coordinates for d1qe0a1:

Click to download the PDB-style file with coordinates for d1qe0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qe0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qe0a2