Lineage for d1qe0a1 (1qe0 A:326-420)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459598Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2459599Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2459600Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 protein domains)
  6. 2459609Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2459627Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry)
  8. 2459628Domain d1qe0a1: 1qe0 A:326-420 [33186]
    Other proteins in same PDB: d1qe0a2, d1qe0b2

Details for d1qe0a1

PDB Entry: 1qe0 (more details), 2.7 Å

PDB Description: crystal structure of apo s. aureus histidyl-trna synthetase
PDB Compounds: (A:) Histidine--tRNA ligase

SCOPe Domain Sequences for d1qe0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfkk

SCOPe Domain Coordinates for d1qe0a1:

Click to download the PDB-style file with coordinates for d1qe0a1.
(The format of our PDB-style files is described here.)

Timeline for d1qe0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qe0a2