| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
| Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) |
| Species Staphylococcus aureus [TaxId:1280] [52958] (1 PDB entry) |
| Domain d1qe0b1: 1qe0 B:326-419 [33187] Other proteins in same PDB: d1qe0a2, d1qe0b2 |
PDB Entry: 1qe0 (more details), 2.7 Å
SCOP Domain Sequences for d1qe0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qe0b1 c.51.1.1 (B:326-419) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus}
ieenldlfivtmgdqadryavkllnhlrhngikadkdylqrkikgqmkqadrlgakftiv
igdqelennkidvknmttgesetieldalveyfk
Timeline for d1qe0b1: