SCOPe 2.08: Domain d5s5xe_: 5s5x E:

Lineage for d5s5xe_ (5s5x E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d5s5xe_: 5s5x E: [407152]
   Other proteins in same PDB: d5s5xa1, d5s5xa2, d5s5xb1, d5s5xb2, d5s5xc1, d5s5xc2, d5s5xd1, d5s5xd2, d5s5xf1, d5s5xf2, d5s5xf3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gtp, mes, mg, s9s

Details for d5s5xe_

PDB Entry: 5s5x, 2.32 Å

PDB Description: tubulin-z45705015-complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s5xe_:

Sequence, based on SEQRES records:

>d5s5xe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d5s5xe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d5s5xe_:

• d5s5xe_ first appeared in SCOPe 2.07