| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
| Domain d5s5xc1: 5s5x C:1-245 [406722] Other proteins in same PDB: d5s5xa2, d5s5xb2, d5s5xc2, d5s5xd2, d5s5xe_, d5s5xf1, d5s5xf2, d5s5xf3 automated match to d5fnva1 complexed with acp, ca, gdp, gtp, mes, mg, s9s |
PDB Entry: 5s5x (more details), 2.32 Å
SCOPe Domain Sequences for d5s5xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s5xc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d5s5xc1: