| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
| Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries) |
| Domain d5s5xf1: 5s5x F:1-76 [407103] Other proteins in same PDB: d5s5xa1, d5s5xa2, d5s5xb1, d5s5xb2, d5s5xc1, d5s5xc2, d5s5xd1, d5s5xd2, d5s5xe_, d5s5xf2, d5s5xf3 automated match to d3tiia1 complexed with acp, ca, gdp, gtp, mes, mg, s9s |
PDB Entry: 5s5x (more details), 2.32 Å
SCOPe Domain Sequences for d5s5xf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s5xf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas
Timeline for d5s5xf1: