Lineage for d1dktb_ (1dkt B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136363Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 136364Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 136365Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 136371Protein CksHs1 [55645] (1 species)
  7. 136372Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries)
  8. 136375Domain d1dktb_: 1dkt B: [40688]

Details for d1dktb_

PDB Entry: 1dkt (more details), 2.9 Å

PDB Description: ckshs1: human cyclin dependent kinase subunit, type 1 complex with metavanadate

SCOP Domain Sequences for d1dktb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dktb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens)}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplpk

SCOP Domain Coordinates for d1dktb_:

Click to download the PDB-style file with coordinates for d1dktb_.
(The format of our PDB-style files is described here.)

Timeline for d1dktb_:

136375
d1dktb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1dkta_