![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
![]() | Protein CksHs1 [55645] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries) |
![]() | Domain d1dkta_: 1dkt A: [40687] |
PDB Entry: 1dkt (more details), 2.9 Å
SCOP Domain Sequences for d1dkta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkta_ d.97.1.1 (A:) CksHs1 {Human (Homo sapiens)} qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep hillfrrplpkk
Timeline for d1dkta_: