| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
| Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
| Protein CksHs1 [55645] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries) |
| Domain d1dktb_: 1dkt B: [40688] |
PDB Entry: 1dkt (more details), 2.9 Å
SCOP Domain Sequences for d1dktb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dktb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens)}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplpk
Timeline for d1dktb_: