![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
![]() | Protein cks1 [55641] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55642] (1 PDB entry) |
![]() | Domain d1qb3a_: 1qb3 A: [40680] |
PDB Entry: 1qb3 (more details), 3 Å
SCOP Domain Sequences for d1qb3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qb3a_ d.97.1.1 (A:) cks1 {Baker's yeast (Saccharomyces cerevisiae)} hafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgt lriltedewrglgitqslgwehyechapephillfkrplnyeaelraataaaq
Timeline for d1qb3a_: