Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d5s4vb2: 5s4v B:246-437 [406474] Other proteins in same PDB: d5s4va1, d5s4vb1, d5s4vc1, d5s4vd1, d5s4ve_, d5s4vf1, d5s4vf2, d5s4vf3 automated match to d3rycd2 complexed with 9ks, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5s4v (more details), 2.3 Å
SCOPe Domain Sequences for d5s4vb2:
Sequence, based on SEQRES records: (download)
>d5s4vb2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqd
>d5s4vb2 d.79.2.1 (B:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrqqyraltvpeltqqmfdsknmmaacdp rhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy qd
Timeline for d5s4vb2: