Lineage for d5s4vb1 (5s4v B:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863314Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)
  8. 2863430Domain d5s4vb1: 5s4v B:1-245 [406473]
    Other proteins in same PDB: d5s4va2, d5s4vb2, d5s4vc2, d5s4vd2, d5s4ve_, d5s4vf1, d5s4vf2, d5s4vf3
    automated match to d4drxb1
    complexed with 9ks, acp, ca, gdp, gtp, mes, mg

Details for d5s4vb1

PDB Entry: 5s4v (more details), 2.3 Å

PDB Description: tubulin-z57040482-complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s4vb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5s4vb1:

Click to download the PDB-style file with coordinates for d5s4vb1.
(The format of our PDB-style files is described here.)

Timeline for d5s4vb1: