Lineage for d1fu0b_ (1fu0 B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) Species Enterococcus faecalis [TaxId:1351] [55598] (3 PDB entries) 
Domain d1fu0b_: 1fu0 B: [40551]
Details for d1fu0b_
PDB Entry: 1fu0 (more details), 1.9 Å
PDB Description: crystal structure analysis of the phospho-serine 46 hpr from enterococcus faecalis
SCOP Domain Sequences for d1fu0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fu0b_ d.94.1.1 (B:) Histidine-containing phosphocarrier proteins (HPr) {Enterococcus faecalis}
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla
SCOP Domain Coordinates for d1fu0b_:
Click to download the PDB-style file with coordinates for d1fu0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fu0b_:
- d1fu0b_ appears in SCOP 1.57
- d1fu0b_ appears in the current release, SCOPe 2.08
View in 3D
