Lineage for d2plea_ (2ple A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34628Protein Phospholipase C-gamma-1 [55577] (1 species)
  7. 34629Species Cow (Bos taurus) [TaxId:9913] [55578] (2 PDB entries)
  8. 34631Domain d2plea_: 2ple A: [40522]

Details for d2plea_

PDB Entry: 2ple (more details)

PDB Description: nuclear magnetic resonance structure of an sh2 domain of phospholipase c-gamma1 complexed with a high affinity binding peptide

SCOP Domain Sequences for d2plea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plea_ d.93.1.1 (A:) Phospholipase C-gamma-1 {Cow (Bos taurus)}
gspgiheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrv
qqegqtvmlgnsefdslvdlisyyekhplyrkmklrypineenss

SCOP Domain Coordinates for d2plea_:

Click to download the PDB-style file with coordinates for d2plea_.
(The format of our PDB-style files is described here.)

Timeline for d2plea_: