Lineage for d1a81k1 (1a81 K:9-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965607Protein Syk tyrosine kinase [55575] (1 species)
  7. 2965608Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 2965619Domain d1a81k1: 1a81 K:9-117 [40517]

Details for d1a81k1

PDB Entry: 1a81 (more details), 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam
PDB Compounds: (K:) syk kinase

SCOPe Domain Sequences for d1a81k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a81k1 d.93.1.1 (K:9-117) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
sanhlpfffgnitreeaedylvqggmsdglyllrqsrnylggfalsvahgrkahhytier
elngtyaiaggrthaspadlchyhsqesdglvcllkkpfnrpqgvqpkt

SCOPe Domain Coordinates for d1a81k1:

Click to download the PDB-style file with coordinates for d1a81k1.
(The format of our PDB-style files is described here.)

Timeline for d1a81k1: