SCOPe 2.08: Domain d1a81e2: 1a81 E:152-262

Lineage for d1a81e2 (1a81 E:152-262)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Syk tyrosine kinase [55575] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)

8. Domain d1a81e2: 1a81 E:152-262 [40512]

Details for d1a81e2

PDB Entry: 1a81, 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

PDB Compounds: (E:) syk kinase

SCOPe Domain Sequences for d1a81e2:

Sequence; same for both SEQRES and ATOM records:

>d1a81e2 d.93.1.1 (E:152-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
pqlekliattahekmpwfhgkisreeseqivligsktngkflirardnngsyalcllheg
kvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqki

Timeline for d1a81e2:

• d1a81e2 first appeared (with stable ids) in SCOP 1.55
  
• d1a81e2 appears in SCOPe 2.07