Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (31 proteins) Pfam 00017 |
Protein Proto-oncogen tyrosine kinase [55573] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55574] (1 PDB entry) |
Domain d1ab2__: 1ab2 - [40506] |
PDB Entry: 1ab2 (more details)
SCOP Domain Sequences for d1ab2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ab2__ d.93.1.1 (-) Proto-oncogen tyrosine kinase {Human (Homo sapiens)} gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd
Timeline for d1ab2__: