SCOP 1.55: Domain d1ab2__: 1ab2 -

Lineage for d1ab2__ (1ab2 -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (19 proteins)

6. Protein Proto-oncogen tyrosine kinase [55573] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55574] (1 PDB entry)

8. Domain d1ab2__: 1ab2 - [40506]

Details for d1ab2__

PDB Entry: 1ab2

PDB Description: three-dimensional solution structure of the src homology 2 domain of c-abl

SCOP Domain Sequences for d1ab2__:

Sequence; same for both SEQRES and ATOM records:

>d1ab2__ d.93.1.1 (-) Proto-oncogen tyrosine kinase {Human (Homo sapiens)}
gsgnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyri
ntasdgklyvssesrfntlaelvhhhstvadglittlhypapkrgihrd

Timeline for d1ab2__:

• d1ab2__ appears in SCOP 1.57
  
• d1ab2__ appears in the current release, SCOPe 2.08, called d1ab2a1