![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein Proto-oncogen tyrosine kinase [55573] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries) |
![]() | Domain d1ab2a1: 1ab2 A:4-104 [40506] Other proteins in same PDB: d1ab2a2, d1ab2a3 |
PDB Entry: 1ab2 (more details)
SCOPe Domain Sequences for d1ab2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ab2a1 d.93.1.1 (A:4-104) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} nslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrinta sdgklyvssesrfntlaelvhhhstvadglittlhypapkr
Timeline for d1ab2a1: