SCOPe 2.08: Domain d1ab2a1: 1ab2 A:4-104

Lineage for d1ab2a1 (1ab2 A:4-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Proto-oncogen tyrosine kinase [55573] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55574] (2 PDB entries)

8. Domain d1ab2a1: 1ab2 A:4-104 [40506]
   Other proteins in same PDB: d1ab2a2, d1ab2a3

Details for d1ab2a1

PDB Entry: 1ab2

PDB Description: three-dimensional solution structure of the src homology 2 domain of c-abl

PDB Compounds: (A:) c-abl tyrosine kinase sh2 domain

SCOPe Domain Sequences for d1ab2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ab2a1 d.93.1.1 (A:4-104) Proto-oncogen tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
nslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrinta
sdgklyvssesrfntlaelvhhhstvadglittlhypapkr

Timeline for d1ab2a1:

• d1ab2a1 first appeared (with stable ids) in SCOP 1.55, called d1ab2__
  
• d1ab2a1 was called d1ab2a_ in SCOPe 2.07