Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein automated matches [190583] (3 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries) |
Domain d7cdlf_: 7cdl F: [404669] Other proteins in same PDB: d7cdla_, d7cdlb_, d7cdlc_, d7cdld_, d7cdlg_, d7cdlh_, d7cdlm_, d7cdln_ automated match to d4tqom_ complexed with ca, pqq |
PDB Entry: 7cdl (more details), 1.85 Å
SCOPe Domain Sequences for d7cdlf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cdlf_ a.137.2.1 (F:) automated matches {Methylococcus capsulatus [TaxId: 243233]} ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak tgkfvykvedi
Timeline for d7cdlf_: