SCOPe 2.08: Domain d7cdle_: 7cdl E:

Lineage for d7cdle_ (7cdl E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (3 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)

8. Domain d7cdle_: 7cdl E: [404612]
   Other proteins in same PDB: d7cdla_, d7cdlb_, d7cdlc_, d7cdld_, d7cdlg_, d7cdlh_, d7cdlm_, d7cdln_
   automated match to d4tqom_
   complexed with ca, pqq

Details for d7cdle_

PDB Entry: 7cdl, 1.85 Å

PDB Description: holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath)

PDB Compounds: (E:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d7cdle_:

Sequence; same for both SEQRES and ATOM records:

>d7cdle_ a.137.2.1 (E:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

Timeline for d7cdle_:

• d7cdle_ first appeared in SCOPe 2.07