Lineage for d7cdlk_ (7cdl K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733707Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2733708Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2733735Protein automated matches [190583] (3 species)
    not a true protein
  7. 2733740Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)
  8. 2733745Domain d7cdlk_: 7cdl K: [404644]
    Other proteins in same PDB: d7cdla_, d7cdlb_, d7cdlc_, d7cdld_, d7cdlg_, d7cdlh_, d7cdlm_, d7cdln_
    automated match to d4tqom_
    complexed with ca, pqq

Details for d7cdlk_

PDB Entry: 7cdl (more details), 1.85 Å

PDB Description: holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath)
PDB Compounds: (K:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d7cdlk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cdlk_ a.137.2.1 (K:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

SCOPe Domain Coordinates for d7cdlk_:

Click to download the PDB-style file with coordinates for d7cdlk_.
(The format of our PDB-style files is described here.)

Timeline for d7cdlk_: