SCOP 1.71: Domain d2ptk_2: 2ptk 146-248

Lineage for d2ptk_2 (2ptk 146-248)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (31 proteins)
   Pfam 00017

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55558] (3 PDB entries)

8. Domain d2ptk_2: 2ptk 146-248 [40457]
   Other proteins in same PDB: d2ptk_1, d2ptk_3

Details for d2ptk_2

PDB Entry: 2ptk, 2.35 Å

PDB Description: chicken src tyrosine kinase

SCOP Domain Sequences for d2ptk_2:

Sequence; same for both SEQRES and ATOM records:

>d2ptk_2 d.93.1.1 (146-248) c-src tyrosine kinase {Chicken (Gallus gallus)}
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpts

Timeline for d2ptk_2:

• d2ptk_2 first appeared (with stable ids) in SCOP 1.55
  
• d2ptk_2 appears in SCOP 1.69
  
• d2ptk_2 is called d2ptka2 in SCOP 1.73
  
• d2ptk_2 appears in the current release, SCOPe 2.08, called d2ptka2