Lineage for d2ptk_2 (2ptk 146-248)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34531Protein c-src tyrosine kinase [55556] (2 species)
  7. 34532Species Chicken (Gallus gallus) [TaxId:9031] [55558] (3 PDB entries)
  8. 34535Domain d2ptk_2: 2ptk 146-248 [40457]
    Other proteins in same PDB: d2ptk_1, d2ptk_3

Details for d2ptk_2

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase

SCOP Domain Sequences for d2ptk_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptk_2 d.93.1.1 (146-248) c-src tyrosine kinase {Chicken (Gallus gallus)}
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpts

SCOP Domain Coordinates for d2ptk_2:

Click to download the PDB-style file with coordinates for d2ptk_2.
(The format of our PDB-style files is described here.)

Timeline for d2ptk_2: