Lineage for d2ptka2 (2ptk A:146-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965247Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries)
  8. 2965252Domain d2ptka2: 2ptk A:146-248 [40457]
    Other proteins in same PDB: d2ptka1, d2ptka3, d2ptka4

Details for d2ptka2

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase
PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d2ptka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptka2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
eewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpts

SCOPe Domain Coordinates for d2ptka2:

Click to download the PDB-style file with coordinates for d2ptka2.
(The format of our PDB-style files is described here.)

Timeline for d2ptka2: