![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein c-src tyrosine kinase [55556] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [55558] (4 PDB entries) |
![]() | Domain d1f1wa_: 1f1w A: [40456] mutant |
PDB Entry: 1f1w (more details), 2.1 Å
SCOPe Domain Sequences for d1f1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1wa_ d.93.1.1 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt
Timeline for d1f1wa_: