PDB entry 1f1w

View 1f1w on RCSB PDB site
Description: src sh2 thref1trp mutant complexed with the phosphopeptide s(ptr)vnvqn
Class: transferase
Keywords: Src, SH2 domain, phosphopeptide, specificity switch, TRANSFERASE
Deposited on 2000-05-20, released 2000-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (1-103)
      • initiating met (0)
      • engineered (71)
    Domains in SCOPe 2.08: d1f1wa_
  • Chain 'B':
    Compound: s(ptr)vnvqn phosphopeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F1W (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f1wA (A:)
maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt

  • Chain 'B':
    No sequence available.