Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
Protein beta-Nerve growth factor [57525] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries) Uniprot P01138 |
Domain d6yw8b_: 6yw8 B: [404246] automated match to d5lsda_ |
PDB Entry: 6yw8 (more details)
SCOPe Domain Sequences for d6yw8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yw8b_ g.17.1.3 (B:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]} ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr
Timeline for d6yw8b_: