PDB entry 6yw8
View 6yw8 on RCSB PDB site
Description: NMR solution structure of unbound recombinant human Nerve Growth Factor (rhNGF)
Class: hormone
Keywords: human NGF, unbound structure, homodimer, cystin-knot, HORMONE
Deposited on
2020-04-29, released
2021-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-06-30, with a file datestamp of
2021-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Beta-nerve growth factor
Species: Homo sapiens [TaxId:9606]
Gene: Ngf, Ngfb
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6yw8a_ - Chain 'B':
Compound: Beta-nerve growth factor
Species: Homo sapiens [TaxId:9606]
Gene: Ngf, Ngfb
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6yw8b_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6yw8A (A:)
ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6yw8B (B:)
ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr