SCOPe 2.07: Domain d6yw8b_: 6yw8 B:

Lineage for d6yw8b_ (6yw8 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein beta-Nerve growth factor [57525] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57527] (6 PDB entries)
   Uniprot P01138

8. Domain d6yw8b_: 6yw8 B: [404246]
   automated match to d5lsda_

Details for d6yw8b_

PDB Entry: 6yw8

PDB Description: nmr solution structure of unbound recombinant human nerve growth factor (rhngf)

PDB Compounds: (B:) Beta-nerve growth factor

SCOPe Domain Sequences for d6yw8b_:

Sequence; same for both SEQRES and ATOM records:

>d6yw8b_ g.17.1.3 (B:) beta-Nerve growth factor {Human (Homo sapiens) [TaxId: 9606]}
ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavr

Timeline for d6yw8b_:

• d6yw8b_ is new in SCOPe 2.07-stable
  
• d6yw8b_ appears in the current release, SCOPe 2.08