Lineage for d1fbza_ (1fbz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965527Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 2965528Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)
  8. 2965540Domain d1fbza_: 1fbz A: [40422]
    complexed with cc1

Details for d1fbza_

PDB Entry: 1fbz (more details), 2.4 Å

PDB Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1fbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbza_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOPe Domain Coordinates for d1fbza_:

Click to download the PDB-style file with coordinates for d1fbza_.
(The format of our PDB-style files is described here.)

Timeline for d1fbza_: