PDB entry 1fbz

View 1fbz on RCSB PDB site
Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity
Class: transferase
Keywords: sh2 domain, nonpeptide inhibitor, transferase
Deposited on 2000-07-17, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239
      • conflict (41)
    Domains in SCOPe 2.08: d1fbza_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-103)
      • conflict (41)
    Domains in SCOPe 2.08: d1fbzb_
  • Heterogens: CC1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbzA (A:)
    epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbzB (B:)
    epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt