Lineage for d1mmq__ (1mmq -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Matrilysin (MMP-9) [55538] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55539] (3 PDB entries) 
Domain d1mmq__: 1mmq - [40396]
Details for d1mmq__
PDB Entry: 1mmq (more details), 1.9 Å
PDB Description: matrilysin complexed with hydroxamate inhibitor
SCOP Domain Sequences for d1mmq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmq__ d.92.1.11 (-) Matrilysin (MMP-9) {Human (Homo sapiens)}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk
SCOP Domain Coordinates for d1mmq__:
Click to download the PDB-style file with coordinates for d1mmq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mmq__:
- d1mmq__ appears in SCOP 1.57
- d1mmq__ appears in the current release, SCOPe 2.08, called d1mmqa_
View in 3D