SCOP 1.63: Domain d1d7xb_: 1d7x B:

Lineage for d1d7xb_ (1d7x B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (30 PDB entries)

8. Domain d1d7xb_: 1d7x B: [40381]
   complexed with ca, spc, zn

Details for d1d7xb_

PDB Entry: 1d7x, 2 Å

PDB Description: crystal structure of mmp3 complexed with a modified proline scaffold based inhibitor.

SCOP Domain Sequences for d1d7xb_:

Sequence; same for both SEQRES and ATOM records:

>d1d7xb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d1d7xb_:

• d1d7xb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7xb_ appears in SCOP 1.61
  
• d1d7xb_ appears in SCOP 1.65
  
• d1d7xb_ appears in the current release, SCOPe 2.08