SCOPe 2.01: Domain d1d7xa_: 1d7x A:

Lineage for d1d7xa_ (1d7x A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (37 PDB entries)

8. Domain d1d7xa_: 1d7x A: [40380]
   complexed with ca, spc, zn

Details for d1d7xa_

PDB Entry: 1d7x, 2 Å

PDB Description: crystal structure of mmp3 complexed with a modified proline scaffold based inhibitor.

PDB Compounds: (A:) stromelysin-1 precursor

SCOPe Domain Sequences for d1d7xa_:

Sequence; same for both SEQRES and ATOM records:

>d1d7xa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

Timeline for d1d7xa_:

• d1d7xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d7xa_ appears in SCOP 1.75
  
• d1d7xa_ appears in SCOPe 2.02
  
• d1d7xa_ appears in the current release, SCOPe 2.08