Lineage for d1d7xa_ (1d7x A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529873Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2529874Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2529904Domain d1d7xa_: 1d7x A: [40380]
    complexed with ca, spc, zn

Details for d1d7xa_

PDB Entry: 1d7x (more details), 2 Å

PDB Description: crystal structure of mmp3 complexed with a modified proline scaffold based inhibitor.
PDB Compounds: (A:) stromelysin-1 precursor

SCOPe Domain Sequences for d1d7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7xa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

SCOPe Domain Coordinates for d1d7xa_:

Click to download the PDB-style file with coordinates for d1d7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1d7xa_: