Lineage for d1d7xa_ (1d7x A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) 
Domain d1d7xa_: 1d7x A: [40380]
Details for d1d7xa_
PDB Entry: 1d7x (more details), 2 Å
PDB Description: crystal structure of mmp3 complexed with a modified proline scaffold based inhibitor.
SCOP Domain Sequences for d1d7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7xa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
SCOP Domain Coordinates for d1d7xa_:
Click to download the PDB-style file with coordinates for d1d7xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d7xa_:
- d1d7xa_ appears in SCOP 1.57
- d1d7xa_ appears in the current release, SCOPe 2.08
View in 3D
