Lineage for d1cqra_ (1cqr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205843Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2205844Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)
  8. 2205868Domain d1cqra_: 1cqr A: [40378]
    complexed with ca, zn

Details for d1cqra_

PDB Entry: 1cqr (more details), 2 Å

PDB Description: crystal structure of the stromelysin catalytic domain at 2.0 a resolution
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1cqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqra_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

SCOPe Domain Coordinates for d1cqra_:

Click to download the PDB-style file with coordinates for d1cqra_.
(The format of our PDB-style files is described here.)

Timeline for d1cqra_: