Lineage for d1cqra_ (1cqr A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34427Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins)
  6. 34480Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 34481Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries)
  8. 34491Domain d1cqra_: 1cqr A: [40378]

Details for d1cqra_

PDB Entry: 1cqr (more details), 2 Å

PDB Description: crystal structure of the stromelysin catalytic domain at 2.0 a resolution

SCOP Domain Sequences for d1cqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqra_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

SCOP Domain Coordinates for d1cqra_:

Click to download the PDB-style file with coordinates for d1cqra_.
(The format of our PDB-style files is described here.)

Timeline for d1cqra_: