SCOPe 2.08: Domain d1cqra_: 1cqr A:

Lineage for d1cqra_ (1cqr A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d1cqra_: 1cqr A: [40378]
   complexed with ca, zn

Details for d1cqra_

PDB Entry: 1cqr, 2 Å

PDB Description: crystal structure of the stromelysin catalytic domain at 2.0 a resolution

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1cqra_:

Sequence; same for both SEQRES and ATOM records:

>d1cqra_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

Timeline for d1cqra_:

• d1cqra_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqra_ appears in SCOPe 2.07