Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries) |
Domain d1cqra_: 1cqr A: [40378] complexed with ca, zn |
PDB Entry: 1cqr (more details), 2 Å
SCOPe Domain Sequences for d1cqra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqra_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
Timeline for d1cqra_: