Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein automated matches [267680] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries) |
Domain d7nhox_: 7nho X: [403766] Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhoz_ automated match to d5v2cx_ complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nho (more details), 2.66 Å
SCOPe Domain Sequences for d7nhox_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhox_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} titpslkgffigllsgavvlgltfavliaisqidk
Timeline for d7nhox_: