Lineage for d7nhoa_ (7nho A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632924Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)
  8. 2632931Domain d7nhoa_: 7nho A: [403744]
    Other proteins in same PDB: d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
    automated match to d2axta1
    complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhoa_

PDB Entry: 7nho (more details), 2.66 Å

PDB Description: structure of psii-m
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d7nhoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhoa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d7nhoa_:

Click to download the PDB-style file with coordinates for d7nhoa_.
(The format of our PDB-style files is described here.)

Timeline for d7nhoa_: