Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein Photosystem II core light harvesting protein PsbB [161079] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161080] (7 PDB entries) Uniprot Q8DIQ1 2-489 |
Domain d7nhob_: 7nho B: [403747] Other proteins in same PDB: d7nhoa_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_ automated match to d2axtb1 complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nho (more details), 2.66 Å
SCOPe Domain Sequences for d7nhob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhob_ f.55.1.1 (B:) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpel
Timeline for d7nhob_: