Lineage for d1bqoa_ (1bqo A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260095Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)
  6. 260176Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 260177Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (30 PDB entries)
  8. 260206Domain d1bqoa_: 1bqo A: [40363]

Details for d1bqoa_

PDB Entry: 1bqo (more details), 2.3 Å

PDB Description: discovery of potent, achiral matrix metalloproteinase inhibitors

SCOP Domain Sequences for d1bqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqoa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

SCOP Domain Coordinates for d1bqoa_:

Click to download the PDB-style file with coordinates for d1bqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bqoa_: